PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00464.1_g00001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family bZIP
Protein Properties Length: 256aa    MW: 27876.7 Da    PI: 5.5499
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00464.1_g00001.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_129.91.2e-0998142751
                              HHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                   bZIP_1   7 errkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkelee 51 
                              e+r   NReA r++R++Kka+ + Le+++  L a N++L k+l +
  Rsa1.0_00464.1_g00001.1  98 EKRPLGNREAVRKYREKKKAKAASLEDECSRLRAVNQQLVKRLGN 142
                              788899**********************************99965 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.3E-992159IPR004827Basic-leucine zipper domain
PfamPF077162.4E-1298143IPR004827Basic-leucine zipper domain
CDDcd146861.18E-1198151No hitNo description
Gene3DG3DSA:1.20.5.1702.6E-1298160No hitNo description
SuperFamilySSF579591.19E-699142No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0071294Biological Processcellular response to zinc ion
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 256 aa     Download sequence    Send to blast
MEEGELELSN NQEVFSSSDV GGGLPPSNSS IDSFFDGLLM DSQHHQQGAC THTHTCNNPT  60
EHTHTHTCFH VHSNILPDDS DEKMSTDDTA ESCGKNGEKR PLGNREAVRK YREKKKAKAA  120
SLEDECSRLR AVNQQLVKRL GNQGALEAEV SRLKCLLVDL RGRIDGEIGS FPYQKPSISI  180
PSFSHLMNPC NVQCGGGDDD EVYCLQDGYE PLSGCDFDQL QCMAANQNLN GSFNSAANVS  240
TTSNKRKGGN RAPKAG
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013670599.11e-134PREDICTED: uncharacterized protein LOC106375275
RefseqXP_013670600.11e-134PREDICTED: uncharacterized protein LOC106375277
SwissprotQ8VY761e-128BZP19_ARATH; Basic leucine zipper 19
TrEMBLA0A078BXN01e-133A0A078BXN0_BRANA; BnaC01g03460D protein
TrEMBLA0A0D3A1V21e-133A0A0D3A1V2_BRAOL; Uncharacterized protein
STRINGAT4G35040.11e-125(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM20362879
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35040.11e-123bZIP family protein